| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338399.1 | internal | 178 | 1-534(+) |
Amino Acid sequence : | |||
| IFPSFHSLLPQIPKPSSIKTVNPNFKPSLPRRFSSAVAATADSAEVGQSLKTLLKNGETLDRIFLLGFSPTLAEIAGLGGYDFDDYDMEHGHGGISDALPCLHALAATQTPAILRIPESS ATWAKEALDLRPQGIMVPMIDGPKSPRKAVSYCRFPPNGARGSAHTAARASSYGIDEG | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 18,915.286 | ||
| Theoretical pI: | 7.139 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 35.334 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.258 | ||
| turn | 0.303 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338399.1 | internal | 178 | 1-534(+) |
Amino Acid sequence : | |||
| IFPSFHSLLPQIPKPSSIKTVNPNFKPSLPRRFSSAVAATADSAEVGQSLKTLLKNGETLDRIFLLGFSPTLAEIAGLGGYDFDDYDMEHGHGGISDALPCLHALAATQTPAILRIPESS ATWAKEALDLRPQGIMVPMIDGPKSPRKAVSYCRFPPNGARGSAHTAARASSYGIDEG | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 18,915.286 | ||
| Theoretical pI: | 7.139 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 35.334 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.258 | ||
| turn | 0.303 | ||
| sheet | 0.270 | ||