| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338413.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| LFSPKRLEALWEIREDEVTAMVESIYHDCTAPDNAGKSLLVKKYLGAVAFNNITRLAFGKRFVNSEGIIDKQGLEFKAIVSNGLKLGASLAMAEHIPSLRWMFPLDEDAFAKHGARRDQL TREIMEEHTRAREESGGAKQHFFDALLTLKDKYDLSEDTIIGLLWDMITAGMDTTAISVEWAMAELIKNPRVQQKAQEELDRVIGYERVMTELDFSNLPYLQCVAKEALRLHPPTPLMLP HRSNSNVKIGGYDIPKGSNVHVN | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 16,833.475 | ||
| Theoretical pI: | 10.384 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 66.132 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.221 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.338 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338413.1 | complete | 157 | 549-76(-) |
Amino Acid sequence : | |||
| MAHSTDIAVVSIPAVIMSQRRPMMVSSLRSYLSLSVSKASKKCCLAPPLSSRARVCSSIISRVSWSRRAPCLAKASSSSGNIQRSDGICSAIAREAPSFSPLETMALNSSPCLSIIPSEF TNRFPNASLVMLLNATAPRYFFTSKLFPALSGAVQSW* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 16,833.475 | ||
| Theoretical pI: | 10.384 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 66.132 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.221 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.338 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338413.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| LFSPKRLEALWEIREDEVTAMVESIYHDCTAPDNAGKSLLVKKYLGAVAFNNITRLAFGKRFVNSEGIIDKQGLEFKAIVSNGLKLGASLAMAEHIPSLRWMFPLDEDAFAKHGARRDQL TREIMEEHTRAREESGGAKQHFFDALLTLKDKYDLSEDTIIGLLWDMITAGMDTTAISVEWAMAELIKNPRVQQKAQEELDRVIGYERVMTELDFSNLPYLQCVAKEALRLHPPTPLMLP HRSNSNVKIGGYDIPKGSNVHVN | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 16,833.475 | ||
| Theoretical pI: | 10.384 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 66.132 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.221 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.338 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338413.1 | complete | 157 | 549-76(-) |
Amino Acid sequence : | |||
| MAHSTDIAVVSIPAVIMSQRRPMMVSSLRSYLSLSVSKASKKCCLAPPLSSRARVCSSIISRVSWSRRAPCLAKASSSSGNIQRSDGICSAIAREAPSFSPLETMALNSSPCLSIIPSEF TNRFPNASLVMLLNATAPRYFFTSKLFPALSGAVQSW* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 16,833.475 | ||
| Theoretical pI: | 10.384 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 66.132 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.221 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.338 | ||
| sheet | 0.261 | ||