| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338418.1 | 5prime_partial | 138 | 731-315(-) |
Amino Acid sequence : | |||
| SKQDVVDALLQQGFSKDVAQWVVTNLRQARINGASSSIFSWIFDLNGIADMYQSYEDTNLWKLVEDVPRGVHINFLKAERSLHRWALEDLRRIHIAEEQAIEEGGGVEMHVLEDAGHWVH ADNPDGLFRILSFSFQGF* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,523.758 | ||
| Theoretical pI: | 5.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 53.882 | ||
| aromaticity | 0.110 | ||
| GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.228 | ||
| sheet | 0.206 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338418.1 | complete | 136 | 162-572(+) |
Amino Acid sequence : | |||
| MAYCCSSQLQNLRRIGSGFPITVNKVMRSLTQCQTELRCISRGGVFHIRRTLKSLEREGKNSKEPVRVVCMNPVPSIFEDVHFDSTALFDGLLLGYVDPAEVFQGPSMQTSFCFEEVYVY TSWDVFHELPEICVFI* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 15,523.758 | ||
| Theoretical pI: | 5.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 53.882 | ||
| aromaticity | 0.110 | ||
| GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.228 | ||
| sheet | 0.206 | ||