Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338418.1 | 5prime_partial | 138 | 731-315(-) |
Amino Acid sequence : | |||
SKQDVVDALLQQGFSKDVAQWVVTNLRQARINGASSSIFSWIFDLNGIADMYQSYEDTNLWKLVEDVPRGVHINFLKAERSLHRWALEDLRRIHIAEEQAIEEGGGVEMHVLEDAGHWVH ADNPDGLFRILSFSFQGF* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,523.758 | ||
Theoretical pI: | 5.891 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 53.882 | ||
aromaticity | 0.110 | ||
GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.228 | ||
sheet | 0.206 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338418.1 | complete | 136 | 162-572(+) |
Amino Acid sequence : | |||
MAYCCSSQLQNLRRIGSGFPITVNKVMRSLTQCQTELRCISRGGVFHIRRTLKSLEREGKNSKEPVRVVCMNPVPSIFEDVHFDSTALFDGLLLGYVDPAEVFQGPSMQTSFCFEEVYVY TSWDVFHELPEICVFI* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 15,523.758 | ||
Theoretical pI: | 5.891 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 53.882 | ||
aromaticity | 0.110 | ||
GRAVY | 0.018 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.228 | ||
sheet | 0.206 |