Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338425.1 | internal | 229 | 2-688(+) |
Amino Acid sequence : | |||
FVYTLIAFSSLLYFYLIWSESAKPKTTTHKAPPEASGAWPVIGHLRIMSGHPSAGIPHVNLGMLADKHGPIFSIRLGVHRVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYDNAML GFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTGLFTTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAEETKRCRRV | |||
Physicochemical properties | |||
Number of amino acids: | 229 | ||
Molecular weight: | 25,481.223 | ||
Theoretical pI: | 9.734 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 37930 | ||
Instability index: | 42.134 | ||
aromaticity | 0.092 | ||
GRAVY | -0.117 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.253 | ||
sheet | 0.258 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338425.1 | internal | 229 | 2-688(+) |
Amino Acid sequence : | |||
FVYTLIAFSSLLYFYLIWSESAKPKTTTHKAPPEASGAWPVIGHLRIMSGHPSAGIPHVNLGMLADKHGPIFSIRLGVHRVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYDNAML GFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTGLFTTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAEETKRCRRV | |||
Physicochemical properties | |||
Number of amino acids: | 229 | ||
Molecular weight: | 25,481.223 | ||
Theoretical pI: | 9.734 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 37930 | ||
Instability index: | 42.134 | ||
aromaticity | 0.092 | ||
GRAVY | -0.117 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.253 | ||
sheet | 0.258 |