Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338430.1 | 5prime_partial | 262 | 3-791(+) |
Amino Acid sequence : | |||
TRYRVKINASLDYAATAGSDLCIVTAGARQNPGETRLDLLHRNVELFHRIVPPLAEQSPECLIMVVSNPVDLLSYVAWKLSGFPVNRVIGSGTNLDSSRFRFLIADHLDVNAQDVQAYIV GEHGDSSVALWSSISVGGVPVLSFLERQQIAYEKETLENIHKEVVQSAYEVIRLKGYTSWAIGYSVANLARSLLRDQRRIHPVSVLAKGFYGIDAEVFLSLPAQLGRNGVLGLTNVHLTE EEVEQLNKSAQTILEFQSQLGI* | |||
Physicochemical properties | |||
Number of amino acids: | 262 | ||
Molecular weight: | 12,220.889 | ||
Theoretical pI: | 11.388 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 93.281 | ||
aromaticity | 0.056 | ||
GRAVY | -0.848 | ||
Secondary Structure Fraction | |||
Helix | 0.241 | ||
turn | 0.287 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338430.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
HPVPRQDQRLPRLRRHRRLRPLHRHRRRPPEPRRDPPRPAPPECRALPPHCAAAGGAVAGVFDYGGVEPGRLAELRGVEAVRVSGEPGYWVGYQFGLVEIPVLDRRSP* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,220.889 | ||
Theoretical pI: | 11.388 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 93.281 | ||
aromaticity | 0.056 | ||
GRAVY | -0.848 | ||
Secondary Structure Fraction | |||
Helix | 0.241 | ||
turn | 0.287 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338430.1 | 5prime_partial | 262 | 3-791(+) |
Amino Acid sequence : | |||
TRYRVKINASLDYAATAGSDLCIVTAGARQNPGETRLDLLHRNVELFHRIVPPLAEQSPECLIMVVSNPVDLLSYVAWKLSGFPVNRVIGSGTNLDSSRFRFLIADHLDVNAQDVQAYIV GEHGDSSVALWSSISVGGVPVLSFLERQQIAYEKETLENIHKEVVQSAYEVIRLKGYTSWAIGYSVANLARSLLRDQRRIHPVSVLAKGFYGIDAEVFLSLPAQLGRNGVLGLTNVHLTE EEVEQLNKSAQTILEFQSQLGI* | |||
Physicochemical properties | |||
Number of amino acids: | 262 | ||
Molecular weight: | 12,220.889 | ||
Theoretical pI: | 11.388 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 93.281 | ||
aromaticity | 0.056 | ||
GRAVY | -0.848 | ||
Secondary Structure Fraction | |||
Helix | 0.241 | ||
turn | 0.287 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338430.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
HPVPRQDQRLPRLRRHRRLRPLHRHRRRPPEPRRDPPRPAPPECRALPPHCAAAGGAVAGVFDYGGVEPGRLAELRGVEAVRVSGEPGYWVGYQFGLVEIPVLDRRSP* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,220.889 | ||
Theoretical pI: | 11.388 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 93.281 | ||
aromaticity | 0.056 | ||
GRAVY | -0.848 | ||
Secondary Structure Fraction | |||
Helix | 0.241 | ||
turn | 0.287 | ||
sheet | 0.231 |