Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338434.1 | 5prime_partial | 186 | 723-163(-) |
Amino Acid sequence : | |||
YVRIHYGNLKRSTKVIHKTLNPKWHQTLEFPDDGSPLTLHVKDHNTLLPTSSIGECVVEYQMLPPNQMADKWIPLQGVKRGEIHVQVTRKVPQLEKKQTTDSPSTIRLKISDQIKQVMEK LRSQVDEDDVEAVLKSLSELESLHESQEEYAIRLENEQMLLIDKIDELGQEILKSSPSLLRTSTIA* | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 11,081.433 | ||
Theoretical pI: | 6.152 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
Instability index: | 72.481 | ||
aromaticity | 0.111 | ||
GRAVY | 0.260 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.323 | ||
sheet | 0.172 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338434.1 | complete | 99 | 170-469(+) |
Amino Acid sequence : | |||
MVEVLRREGDDLRISCPSSSILSISSICSFSSRIAYSSWLSWRLSSSLNDFRTASTSSSSTCDRSFSITCLIWSEILRRIVEGESVVCFFSSWGTFLVT* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,081.433 | ||
Theoretical pI: | 6.152 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
Instability index: | 72.481 | ||
aromaticity | 0.111 | ||
GRAVY | 0.260 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.323 | ||
sheet | 0.172 |