Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338451.1	internal	211	1-633(+)
Amino Acid sequence :
FISTLLPFPLKILHAATAIRFDIQNKCSYTIWPPVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSVLD GYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPE
Physicochemical properties
Number of amino acids:		211
Molecular weight:		12,589.852
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		88.015
aromaticity		0.024
GRAVY		-0.664
Secondary Structure Fraction
Helix		0.079
turn		0.449
sheet		0.220

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338451.1	5prime_partial	159	633-154(-)
Amino Acid sequence :
LRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDGDVVVVLPPEVVEAVLRLGVRRRAEG GAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG*
Physicochemical properties
Number of amino acids:		159
Molecular weight:		12,589.852
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		88.015
aromaticity		0.024
GRAVY		-0.664
Secondary Structure Fraction
Helix		0.079
turn		0.449
sheet		0.220

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338451.1	5prime_partial	127	2-385(+)
Amino Acid sequence :
SSPLSSLSPLKSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTSPSWT ATICRWR*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		12,589.852
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		88.015
aromaticity		0.024
GRAVY		-0.664
Secondary Structure Fraction
Helix		0.079
turn		0.449
sheet		0.220

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338451.1	internal	211	1-633(+)
Amino Acid sequence :
FISTLLPFPLKILHAATAIRFDIQNKCSYTIWPPVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSVLD GYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPE
Physicochemical properties
Number of amino acids:		211
Molecular weight:		12,589.852
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		88.015
aromaticity		0.024
GRAVY		-0.664
Secondary Structure Fraction
Helix		0.079
turn		0.449
sheet		0.220

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338451.1	5prime_partial	159	633-154(-)
Amino Acid sequence :
LRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDGDVVVVLPPEVVEAVLRLGVRRRAEG GAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG*
Physicochemical properties
Number of amino acids:		159
Molecular weight:		12,589.852
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		88.015
aromaticity		0.024
GRAVY		-0.664
Secondary Structure Fraction
Helix		0.079
turn		0.449
sheet		0.220

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338451.1	5prime_partial	127	2-385(+)
Amino Acid sequence :
SSPLSSLSPLKSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTSPSWT ATICRWR*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		12,589.852
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		88.015
aromaticity		0.024
GRAVY		-0.664
Secondary Structure Fraction
Helix		0.079
turn		0.449
sheet		0.220