| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338457.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
| HPLCFFIYHRFIIMNALAATNRNFKLAARLLGLDSKLQKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGC NPSDLSISELERLTRVFTQKIHDLIGSHTDVPAPDMGTGPQTMAWILDEYSKFHGYSPAVVTGKPIDLGGSLGRDAATGRGVLFGTEALLNEFGKSIAGQRVVIQGFGNVGSWAAQLISE QGGIIVAVSDITGAIKNPNG | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 13,939.223 | ||
| Theoretical pI: | 9.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 37.168 | ||
| aromaticity | 0.134 | ||
| GRAVY | 0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.323 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338457.1 | 3prime_partial | 127 | 381-1(-) |
Amino Acid sequence : | |||
| MLKSDGLHPIPPLAPPYGIFATAVFHVINWARAFTSSGSTSGWYLMPPFIGPRALSCWTLNPTNDAKVPSSFGIVHSTLISLKGINKLFCNFESSPSSRAASLKFLFVAAKAFMIMNLWY MKKHNGC | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,939.223 | ||
| Theoretical pI: | 9.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 37.168 | ||
| aromaticity | 0.134 | ||
| GRAVY | 0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.323 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338457.1 | internal | 260 | 2-781(+) |
Amino Acid sequence : | |||
| HPLCFFIYHRFIIMNALAATNRNFKLAARLLGLDSKLQKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGC NPSDLSISELERLTRVFTQKIHDLIGSHTDVPAPDMGTGPQTMAWILDEYSKFHGYSPAVVTGKPIDLGGSLGRDAATGRGVLFGTEALLNEFGKSIAGQRVVIQGFGNVGSWAAQLISE QGGIIVAVSDITGAIKNPNG | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 13,939.223 | ||
| Theoretical pI: | 9.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 37.168 | ||
| aromaticity | 0.134 | ||
| GRAVY | 0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.323 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338457.1 | 3prime_partial | 127 | 381-1(-) |
Amino Acid sequence : | |||
| MLKSDGLHPIPPLAPPYGIFATAVFHVINWARAFTSSGSTSGWYLMPPFIGPRALSCWTLNPTNDAKVPSSFGIVHSTLISLKGINKLFCNFESSPSSRAASLKFLFVAAKAFMIMNLWY MKKHNGC | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,939.223 | ||
| Theoretical pI: | 9.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 37.168 | ||
| aromaticity | 0.134 | ||
| GRAVY | 0.254 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.323 | ||
| sheet | 0.236 | ||