Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338458.1 | 5prime_partial | 197 | 787-194(-) |
Amino Acid sequence : | |||
GNVGSWAAQLISEQGGIIVAVSDITGAIKNPNGLDIPRLVKHVREARGVKGFAGADSIDPDSILVEDCDILIPAALGGVINKDNAKEIKAKFIIEAANHPTDPEGDEILAKKGVVVLPDI YANSGGVTVSYFEWVQNIQGFMWDEEKVNSELKTYMTRGFKDVKEMCRTHNCDLRMGAFSLGVNRVARATLLRGWEA* | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 11,560.535 | ||
Theoretical pI: | 11.367 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 82.253 | ||
aromaticity | 0.063 | ||
GRAVY | 0.389 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.360 | ||
sheet | 0.288 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338458.1 | complete | 111 | 429-764(+) |
Amino Acid sequence : | |||
MSGRTTTPFFASISSPSGSVGWLAASIMNLALISLALSLFMTPPRAAGIKMSQSSTKIESGSIESAPAKPFTPRASRTCLTRRGMSSPLGFFIAPVMSLTATMIPPCSLMS* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,560.535 | ||
Theoretical pI: | 11.367 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 82.253 | ||
aromaticity | 0.063 | ||
GRAVY | 0.389 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.360 | ||
sheet | 0.288 |