Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338460.1	complete	131	136-531(+)
Amino Acid sequence :
MIPLYNNCRTKNDITLKSKNLSCLNNTNKSYFKSKYGLNNAIDLTFTSVLKLNLLMPPFSSEVDHRDFNRHSWSLAICLLMADIFKCRGGTICISNKCWLLLAIDTIMIWGRDPYWGGCK IWLGLNLNNRL*
Physicochemical properties
Number of amino acids:		131
Molecular weight:		15,080.571
Theoretical pI:		9.300
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		33460 33835
Instability index:		22.173
aromaticity		0.107
GRAVY		-0.034
Secondary Structure Fraction
Helix		0.359
turn		0.275
sheet		0.221