| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338464.1 | internal | 269 | 3-809(+) |
Amino Acid sequence : | |||
| TMSERCFDVGIAEQPLETFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFMMDRAGLVGADGPTHCGAFDTTYMACLPNMVVMAPSNEAELMHMIATAAIIDDRPSCVRYP RGNGVGAPLPPNNKGTPLEIGKGRILKEGNRVAILGFGTIVQNCLAAAGVLEEHGISATVADARFCKPLDGDLIKNLVKEHEILITVEEGSIGGFSAHVSHFLSLNELLDGNLKWRPMVL PDRYIEHGGHPDQIEEAGLSSKHIAATVL | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 28,944.954 | ||
| Theoretical pI: | 5.330 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 36.628 | ||
| aromaticity | 0.059 | ||
| GRAVY | 0.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.242 | ||
| sheet | 0.297 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338464.1 | internal | 269 | 3-809(+) |
Amino Acid sequence : | |||
| TMSERCFDVGIAEQPLETFAAGLATEGLKPFCAIYSSFLQRGYDQVVHDVDLQKLPVRFMMDRAGLVGADGPTHCGAFDTTYMACLPNMVVMAPSNEAELMHMIATAAIIDDRPSCVRYP RGNGVGAPLPPNNKGTPLEIGKGRILKEGNRVAILGFGTIVQNCLAAAGVLEEHGISATVADARFCKPLDGDLIKNLVKEHEILITVEEGSIGGFSAHVSHFLSLNELLDGNLKWRPMVL PDRYIEHGGHPDQIEEAGLSSKHIAATVL | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 28,944.954 | ||
| Theoretical pI: | 5.330 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 36.628 | ||
| aromaticity | 0.059 | ||
| GRAVY | 0.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.242 | ||
| sheet | 0.297 | ||