| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338474.1 | 3prime_partial | 237 | 53-763(+) |
Amino Acid sequence : | |||
| MGKEKTHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDGIMEPKRPSDKPLRLP | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 12,255.805 | ||
| Theoretical pI: | 5.831 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 28.749 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.313 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338474.1 | 3prime_partial | 112 | 337-2(-) |
Amino Acid sequence : | |||
| MAGSINNRAVVFGGLEFPQRNINGDTTLTLSLELVKYPCILEGPLVHLSSFLLKPLNDTLVNTTKLVNQMPSGGRLSRVDVANDHNANVSLFLTHVSSINLYGYESRENLEA | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,255.805 | ||
| Theoretical pI: | 5.831 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 28.749 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.313 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338474.1 | 3prime_partial | 237 | 53-763(+) |
Amino Acid sequence : | |||
| MGKEKTHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDGIMEPKRPSDKPLRLP | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 12,255.805 | ||
| Theoretical pI: | 5.831 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 28.749 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.313 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338474.1 | 3prime_partial | 112 | 337-2(-) |
Amino Acid sequence : | |||
| MAGSINNRAVVFGGLEFPQRNINGDTTLTLSLELVKYPCILEGPLVHLSSFLLKPLNDTLVNTTKLVNQMPSGGRLSRVDVANDHNANVSLFLTHVSSINLYGYESRENLEA | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,255.805 | ||
| Theoretical pI: | 5.831 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 28.749 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.313 | ||
| sheet | 0.277 | ||