| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338500.1 | internal | 154 | 1-462(+) |
Amino Acid sequence : | |||
| TSSRRRNPASAAGSSSWPPRTSPPSPSSKPSEARSPTNTPRACPGTATTVVTRSSTRSRTSLAHVPSRPTDSTPPNGASMSSLTAAPPVISRPTRLFSTPTTGSWASSCLPAAISRGATT LPAGRRSVPPRSTSRACRTRLIPRRGTLITIGWR | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 11,071.186 | ||
| Theoretical pI: | 7.946 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
| Instability index: | 37.062 | ||
| aromaticity | 0.129 | ||
| GRAVY | -0.533 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.347 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338500.1 | complete | 101 | 126-431(+) |
Amino Acid sequence : | |||
| MPGNRYYGGNEVFDEIENLARSRALQAYRLDPTKWGVNVQPYSGSPGNFAAYTAVLNPHDRIMGLELPSGGNLTRGYYTSGGKKISAASIYFESLPYKADS* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,071.186 | ||
| Theoretical pI: | 7.946 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
| Instability index: | 37.062 | ||
| aromaticity | 0.129 | ||
| GRAVY | -0.533 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.347 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338500.1 | internal | 154 | 1-462(+) |
Amino Acid sequence : | |||
| TSSRRRNPASAAGSSSWPPRTSPPSPSSKPSEARSPTNTPRACPGTATTVVTRSSTRSRTSLAHVPSRPTDSTPPNGASMSSLTAAPPVISRPTRLFSTPTTGSWASSCLPAAISRGATT LPAGRRSVPPRSTSRACRTRLIPRRGTLITIGWR | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 11,071.186 | ||
| Theoretical pI: | 7.946 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
| Instability index: | 37.062 | ||
| aromaticity | 0.129 | ||
| GRAVY | -0.533 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.347 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338500.1 | complete | 101 | 126-431(+) |
Amino Acid sequence : | |||
| MPGNRYYGGNEVFDEIENLARSRALQAYRLDPTKWGVNVQPYSGSPGNFAAYTAVLNPHDRIMGLELPSGGNLTRGYYTSGGKKISAASIYFESLPYKADS* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,071.186 | ||
| Theoretical pI: | 7.946 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
| Instability index: | 37.062 | ||
| aromaticity | 0.129 | ||
| GRAVY | -0.533 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.347 | ||
| sheet | 0.238 | ||