Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338534.1 | internal | 259 | 2-778(+) |
Amino Acid sequence : | |||
HQSWTLVLHFSQSLSLEMTKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPEEIPWAETGAEYIVESTGV FTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVL PALNGKLTGMAFRVPTVDV | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 12,747.321 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 34.524 | ||
aromaticity | 0.079 | ||
GRAVY | 0.004 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.333 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338534.1 | complete | 119 | 567-208(-) |
Amino Acid sequence : | |||
MPNRSLITFANGARQFVVQLALDTMLRSGVYVFSLTPTTNIGASLLGAEIMTFLAPPFKWAAALSLSVKTPVDSTMYSAPVSAHGISSGFLMPKTVTDFSPKRRVFSSLTLSSWCFHWP* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 12,747.321 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 34.524 | ||
aromaticity | 0.079 | ||
GRAVY | 0.004 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.333 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338534.1 | complete | 114 | 391-47(-) |
Amino Acid sequence : | |||
MGCSLIFVSENTSGLHNVFSTSLSPWNLFWVSDAKNSHRFFTKEKGFLILNLELMVLPLAMNTVILEHIGHVISSDERIVDSNKLNVVSLKSNPSNETANSSESINSDLNLRHF* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,747.321 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 34.524 | ||
aromaticity | 0.079 | ||
GRAVY | 0.004 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.333 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338534.1 | internal | 259 | 2-778(+) |
Amino Acid sequence : | |||
HQSWTLVLHFSQSLSLEMTKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPEEIPWAETGAEYIVESTGV FTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVL PALNGKLTGMAFRVPTVDV | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 12,747.321 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 34.524 | ||
aromaticity | 0.079 | ||
GRAVY | 0.004 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.333 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338534.1 | complete | 119 | 567-208(-) |
Amino Acid sequence : | |||
MPNRSLITFANGARQFVVQLALDTMLRSGVYVFSLTPTTNIGASLLGAEIMTFLAPPFKWAAALSLSVKTPVDSTMYSAPVSAHGISSGFLMPKTVTDFSPKRRVFSSLTLSSWCFHWP* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 12,747.321 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 34.524 | ||
aromaticity | 0.079 | ||
GRAVY | 0.004 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.333 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338534.1 | complete | 114 | 391-47(-) |
Amino Acid sequence : | |||
MGCSLIFVSENTSGLHNVFSTSLSPWNLFWVSDAKNSHRFFTKEKGFLILNLELMVLPLAMNTVILEHIGHVISSDERIVDSNKLNVVSLKSNPSNETANSSESINSDLNLRHF* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,747.321 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 34.524 | ||
aromaticity | 0.079 | ||
GRAVY | 0.004 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.333 | ||
sheet | 0.246 |