| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338542.1 | 3prime_partial | 206 | 14-631(+) |
Amino Acid sequence : | |||
| MHKSTSTSSLGPCGLDLTQTFFAPIDGGAPPHPTKRHTKITVVGVGNVGMAIAQTIITQDLADELTLVDAKEDKLRGEVLDLRHAAAFLPRVKINASLDYAATAGSDLCIVTAGARQNPG ETRLDLLHRNVELFHRIVPPLAEQSPECLIMVVSNPVDLLSYVAWKLSGIPVNRVIGSGTNLDSSRFRFLIADHLDVNAQDVQAYI | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 15,391.616 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 146.955 | ||
| aromaticity | 0.008 | ||
| GRAVY | -2.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.105 | ||
| turn | 0.266 | ||
| sheet | 0.153 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338542.1 | 5prime_partial | 152 | 3-461(+) |
Amino Acid sequence : | |||
| TLKICTKAPPPPPSALAASTSPKPSSLPSTAALRRTPPSATPRSPSSASATSAWPSPRPSSPRTSPTSSPSSTPRRTSSAARSSTSATPPPSSPASRSTPPSTTPPPPDPTSASSPPAPA RTPVRPASTCSTGMSSSSTALCRRWRSSRRSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 15,391.616 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 146.955 | ||
| aromaticity | 0.008 | ||
| GRAVY | -2.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.105 | ||
| turn | 0.266 | ||
| sheet | 0.153 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338542.1 | 5prime_partial | 124 | 1-375(+) |
Amino Acid sequence : | |||
| APLKYAQKHLHLLPRPLRPRPHPNLLRSHRRRRSAAPHQAPHQDHRRRRRQRRHGHRPDHHHPGPRRRAHPRRRQGGQAPRRGPRPPPRRRLPPPRQDQRLPRLRRHRRIRPLHRHRRRP PEPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 15,391.616 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 146.955 | ||
| aromaticity | 0.008 | ||
| GRAVY | -2.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.105 | ||
| turn | 0.266 | ||
| sheet | 0.153 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338542.1 | 3prime_partial | 206 | 14-631(+) |
Amino Acid sequence : | |||
| MHKSTSTSSLGPCGLDLTQTFFAPIDGGAPPHPTKRHTKITVVGVGNVGMAIAQTIITQDLADELTLVDAKEDKLRGEVLDLRHAAAFLPRVKINASLDYAATAGSDLCIVTAGARQNPG ETRLDLLHRNVELFHRIVPPLAEQSPECLIMVVSNPVDLLSYVAWKLSGIPVNRVIGSGTNLDSSRFRFLIADHLDVNAQDVQAYI | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 15,391.616 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 146.955 | ||
| aromaticity | 0.008 | ||
| GRAVY | -2.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.105 | ||
| turn | 0.266 | ||
| sheet | 0.153 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338542.1 | 5prime_partial | 152 | 3-461(+) |
Amino Acid sequence : | |||
| TLKICTKAPPPPPSALAASTSPKPSSLPSTAALRRTPPSATPRSPSSASATSAWPSPRPSSPRTSPTSSPSSTPRRTSSAARSSTSATPPPSSPASRSTPPSTTPPPPDPTSASSPPAPA RTPVRPASTCSTGMSSSSTALCRRWRSSRRSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 15,391.616 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 146.955 | ||
| aromaticity | 0.008 | ||
| GRAVY | -2.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.105 | ||
| turn | 0.266 | ||
| sheet | 0.153 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338542.1 | 5prime_partial | 124 | 1-375(+) |
Amino Acid sequence : | |||
| APLKYAQKHLHLLPRPLRPRPHPNLLRSHRRRRSAAPHQAPHQDHRRRRRQRRHGHRPDHHHPGPRRRAHPRRRQGGQAPRRGPRPPPRRRLPPPRQDQRLPRLRRHRRIRPLHRHRRRP PEPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 15,391.616 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 146.955 | ||
| aromaticity | 0.008 | ||
| GRAVY | -2.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.105 | ||
| turn | 0.266 | ||
| sheet | 0.153 | ||