| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338553.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
| HAVFPCRKIQSTEAMEEISDYKSLEIKRKSPNSRVFHLIFNRPSRGNALSPEFFNEFPHALSALDRNPEVAVIILSGAGKHFCTGIELQLLLTATAPGEDRGRTGEKLRRGIKDMQRAVT AVEDCRKPVIAAVHGACIGGAVDIITACDLRYCTETANFSVKEVEVGLAADLGTLQRLPGIVGFGNAMELALTARHFSGVEAKELGLVSRVFSDKAAMDEGVAQVAEGIAGRAPPAIMGT KRVLI | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 15,863.887 | ||
| Theoretical pI: | 9.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
| Instability index: | 76.978 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.241 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338553.1 | complete | 197 | 654-61(-) |
Amino Acid sequence : | |||
| MAALSLKTRLTNPNSFASTPEKWRAVSASSIAFPNPTIPGSLCSVPRSAASPTSTSFTEKFAVSVQYLKSHAVIISTAPPMQAPCTAAITGFLQSSTAVTARCISLIPRRSFSPVRPLSS PGAVAVSRSWSSIPVQKCFPAPERMMTATSGLRSRAESAWGNSLKNSGERALPREGRLKIRWNTLEFGDFRLISRDL* | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 15,863.887 | ||
| Theoretical pI: | 9.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
| Instability index: | 76.978 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.241 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338553.1 | 5prime_partial | 137 | 736-323(-) |
Amino Acid sequence : | |||
| NQHSFCSHYCRGSPPCNPLSNLSNPFVHGCLIAENSTHQSQFLCLHAGEVARRQCQLHRIPEPYDSRQPLQRPQICRQPHLHLLHREIRRLCAIPQVARRYYIHRSADASSVHRRDHRLS AILHRRHGSLHILDSAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,863.887 | ||
| Theoretical pI: | 9.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
| Instability index: | 76.978 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.241 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338553.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
| HAVFPCRKIQSTEAMEEISDYKSLEIKRKSPNSRVFHLIFNRPSRGNALSPEFFNEFPHALSALDRNPEVAVIILSGAGKHFCTGIELQLLLTATAPGEDRGRTGEKLRRGIKDMQRAVT AVEDCRKPVIAAVHGACIGGAVDIITACDLRYCTETANFSVKEVEVGLAADLGTLQRLPGIVGFGNAMELALTARHFSGVEAKELGLVSRVFSDKAAMDEGVAQVAEGIAGRAPPAIMGT KRVLI | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 15,863.887 | ||
| Theoretical pI: | 9.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
| Instability index: | 76.978 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.241 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338553.1 | complete | 197 | 654-61(-) |
Amino Acid sequence : | |||
| MAALSLKTRLTNPNSFASTPEKWRAVSASSIAFPNPTIPGSLCSVPRSAASPTSTSFTEKFAVSVQYLKSHAVIISTAPPMQAPCTAAITGFLQSSTAVTARCISLIPRRSFSPVRPLSS PGAVAVSRSWSSIPVQKCFPAPERMMTATSGLRSRAESAWGNSLKNSGERALPREGRLKIRWNTLEFGDFRLISRDL* | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 15,863.887 | ||
| Theoretical pI: | 9.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
| Instability index: | 76.978 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.241 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338553.1 | 5prime_partial | 137 | 736-323(-) |
Amino Acid sequence : | |||
| NQHSFCSHYCRGSPPCNPLSNLSNPFVHGCLIAENSTHQSQFLCLHAGEVARRQCQLHRIPEPYDSRQPLQRPQICRQPHLHLLHREIRRLCAIPQVARRYYIHRSADASSVHRRDHRLS AILHRRHGSLHILDSAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,863.887 | ||
| Theoretical pI: | 9.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
| Instability index: | 76.978 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.241 | ||
| sheet | 0.212 | ||