Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338553.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
HAVFPCRKIQSTEAMEEISDYKSLEIKRKSPNSRVFHLIFNRPSRGNALSPEFFNEFPHALSALDRNPEVAVIILSGAGKHFCTGIELQLLLTATAPGEDRGRTGEKLRRGIKDMQRAVT AVEDCRKPVIAAVHGACIGGAVDIITACDLRYCTETANFSVKEVEVGLAADLGTLQRLPGIVGFGNAMELALTARHFSGVEAKELGLVSRVFSDKAAMDEGVAQVAEGIAGRAPPAIMGT KRVLI | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 15,863.887 | ||
Theoretical pI: | 9.897 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
Instability index: | 76.978 | ||
aromaticity | 0.051 | ||
GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.241 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338553.1 | complete | 197 | 654-61(-) |
Amino Acid sequence : | |||
MAALSLKTRLTNPNSFASTPEKWRAVSASSIAFPNPTIPGSLCSVPRSAASPTSTSFTEKFAVSVQYLKSHAVIISTAPPMQAPCTAAITGFLQSSTAVTARCISLIPRRSFSPVRPLSS PGAVAVSRSWSSIPVQKCFPAPERMMTATSGLRSRAESAWGNSLKNSGERALPREGRLKIRWNTLEFGDFRLISRDL* | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 15,863.887 | ||
Theoretical pI: | 9.897 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
Instability index: | 76.978 | ||
aromaticity | 0.051 | ||
GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.241 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338553.1 | 5prime_partial | 137 | 736-323(-) |
Amino Acid sequence : | |||
NQHSFCSHYCRGSPPCNPLSNLSNPFVHGCLIAENSTHQSQFLCLHAGEVARRQCQLHRIPEPYDSRQPLQRPQICRQPHLHLLHREIRRLCAIPQVARRYYIHRSADASSVHRRDHRLS AILHRRHGSLHILDSAA* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,863.887 | ||
Theoretical pI: | 9.897 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
Instability index: | 76.978 | ||
aromaticity | 0.051 | ||
GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.241 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338553.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
HAVFPCRKIQSTEAMEEISDYKSLEIKRKSPNSRVFHLIFNRPSRGNALSPEFFNEFPHALSALDRNPEVAVIILSGAGKHFCTGIELQLLLTATAPGEDRGRTGEKLRRGIKDMQRAVT AVEDCRKPVIAAVHGACIGGAVDIITACDLRYCTETANFSVKEVEVGLAADLGTLQRLPGIVGFGNAMELALTARHFSGVEAKELGLVSRVFSDKAAMDEGVAQVAEGIAGRAPPAIMGT KRVLI | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 15,863.887 | ||
Theoretical pI: | 9.897 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
Instability index: | 76.978 | ||
aromaticity | 0.051 | ||
GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.241 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338553.1 | complete | 197 | 654-61(-) |
Amino Acid sequence : | |||
MAALSLKTRLTNPNSFASTPEKWRAVSASSIAFPNPTIPGSLCSVPRSAASPTSTSFTEKFAVSVQYLKSHAVIISTAPPMQAPCTAAITGFLQSSTAVTARCISLIPRRSFSPVRPLSS PGAVAVSRSWSSIPVQKCFPAPERMMTATSGLRSRAESAWGNSLKNSGERALPREGRLKIRWNTLEFGDFRLISRDL* | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 15,863.887 | ||
Theoretical pI: | 9.897 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
Instability index: | 76.978 | ||
aromaticity | 0.051 | ||
GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.241 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338553.1 | 5prime_partial | 137 | 736-323(-) |
Amino Acid sequence : | |||
NQHSFCSHYCRGSPPCNPLSNLSNPFVHGCLIAENSTHQSQFLCLHAGEVARRQCQLHRIPEPYDSRQPLQRPQICRQPHLHLLHREIRRLCAIPQVARRYYIHRSADASSVHRRDHRLS AILHRRHGSLHILDSAA* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,863.887 | ||
Theoretical pI: | 9.897 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
Instability index: | 76.978 | ||
aromaticity | 0.051 | ||
GRAVY | -0.642 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.241 | ||
sheet | 0.212 |