Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338557.1 | 5prime_partial | 166 | 2-502(+) |
Amino Acid sequence : | |||
HQSPLQYPQVLHPAADSININAQIWDMYFKNLLPRLVKEGDDGNYGSAASCDTICLQALSKRIHYGKFVAEAKFRKSPDEYTPAIKAQDKDELMRLLTYVDVEEVVRRRVERKTRKYGQE VTLTEDAENTEPVYKINPSIVADLYWDWIMPLTKQVQVEYLLRRLD* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 19,348.826 | ||
Theoretical pI: | 5.979 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
Instability index: | 54.239 | ||
aromaticity | 0.096 | ||
GRAVY | -0.558 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.163 | ||
sheet | 0.259 |