Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338566.1 | 5prime_partial | 191 | 1-576(+) |
Amino Acid sequence : | |||
APVYYFNKVGWPENAPLTEEERKEFIAGLHKRKTELFMVLIEKKLLPLRPGVEKLIDQALGNGVKVAVCSTSNEKAVSAIVSCLLGPERAEQIRIFAGDVVPRKKPDPAIYLLAAETLAV DPSSCVVVEDSGIGLAAAKAAGMTCIVTKSGYTAEENFSNADAVFDCIGDPPEERFDLAFCGSLLEKQYVS* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 13,515.517 | ||
Theoretical pI: | 7.669 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
Instability index: | 80.134 | ||
aromaticity | 0.078 | ||
GRAVY | -0.370 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.200 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338566.1 | complete | 115 | 538-191(-) |
Amino Acid sequence : | |||
MPSQTVPQEDLQCNQKLHLHLKNSPLLCTHSWSQCTSFQLLWQLQDLCHYLLRQHNLKDQPQGFRLLTDKWPDQASCEEPHHLQISGSVLLALVPTSTRLWLRPPFHWKCCILQL* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,515.517 | ||
Theoretical pI: | 7.669 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
Instability index: | 80.134 | ||
aromaticity | 0.078 | ||
GRAVY | -0.370 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.200 | ||
sheet | 0.252 |