| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338570.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
| HPLNGSKSLPPHHQTKSPHPSTINIPPPTAAEHGHRRRRRRESIILGHHPGRHKFGSEESHPNKIAGDGLRAHAPPSTLSAPATTASALCVAACELIGWPLGAKPSPPHSAIHLMHAAAH AHEHLPLTDGSRPDYKPDIQHKFNPNIELLTGDGIAPFGYKLLARSINDPGQNQNPARILRVIIEISHAAGSQGLIDGLYKEAEIVDPLSRFRFVEYVCRKKYGEIHGCGAACGAILAGG ADEEIEKLRN | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 11,113.690 | ||
| Theoretical pI: | 9.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
| Instability index: | 90.873 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
| Helix | 0.233 | ||
| turn | 0.311 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338570.1 | complete | 179 | 13-552(+) |
Amino Acid sequence : | |||
| MALNLSHLTTKQSPPIQALSTFRRPPPPSMATAVAVAGNQSYWDTIQDDINSDLKKAIPIRSPETVFEPMHHHRPSPPPPPPPPPSAWRLASSSAGHSEPSHRRRTPPYTSCMRRPTPTS TSPSPTAPGPITSPISNTSSTPTLSSSPATGSPRSGTSCWPDPSTTRARTRTRPGSCEL* | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 11,113.690 | ||
| Theoretical pI: | 9.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
| Instability index: | 90.873 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
| Helix | 0.233 | ||
| turn | 0.311 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338570.1 | complete | 103 | 346-35(-) |
Amino Acid sequence : | |||
| MRCMAECGGDGLAPSGQPMSSQAATQRAEAVVAGAERVDGGAWARRPSPAILLGWLSSDPNLCRPGWCPNMIDSRRRRRRWPCSAAVGGGMLIVLGWGDFVWW* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,113.690 | ||
| Theoretical pI: | 9.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
| Instability index: | 90.873 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
| Helix | 0.233 | ||
| turn | 0.311 | ||
| sheet | 0.272 | ||