Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338572.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
TPSRAEFGTRQERQDAMYKLVEDKMDLILVVGGWNSSNTSHLQEIAELRGIPSYWVDSEKRIGPGSKISHKLMHGELVEKENWLPEGPITIGVTSGASTPDKVVEDVLQRVFDLKREELL QSV* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,830.496 | ||
Theoretical pI: | 5.199 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 58.035 | ||
aromaticity | 0.057 | ||
GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.244 | ||
sheet | 0.260 |