Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338574.1 | internal | 234 | 3-704(+) |
Amino Acid sequence : | |||
THKESSDHLLQMRRPSIGLCVNHILLDGMSAKDFNENLASQAFDDKPLSVVPCFDRRLLAARSPPQPAFDHREFKPNLGPASTPPVFDCTKEHLEYRVFQLYPPHINLLKQKAKPESGRI SGLTAAAALMWKCKALSKDESYNGNRVSTLLNVLDLRSRLREPALPPNYCGNALLVAYSTAACGEIAAAEFAELAERVAAAPGRVTEEYARSALDWLEVHRGLPFGEYMVSSWL | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 10,829.102 | ||
Theoretical pI: | 11.382 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 106.979 | ||
aromaticity | 0.038 | ||
GRAVY | -0.664 | ||
Secondary Structure Fraction | |||
Helix | 0.105 | ||
turn | 0.457 | ||
sheet | 0.190 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338574.1 | complete | 119 | 391-32(-) |
Amino Acid sequence : | |||
MSAAAAVRPLIRPDSGLAFCLRRFMWGGYNWKTRYSRCSLVQSKTGGVEAGPRFGLNSRWSKAGCGGERAARRRRSKQGTTDKGLSSKACEARFSLKSLALIPSSKMWFTQSPMEGRRI* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 10,829.102 | ||
Theoretical pI: | 11.382 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 106.979 | ||
aromaticity | 0.038 | ||
GRAVY | -0.664 | ||
Secondary Structure Fraction | |||
Helix | 0.105 | ||
turn | 0.457 | ||
sheet | 0.190 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338574.1 | 5prime_partial | 105 | 705-388(-) |
Amino Acid sequence : | |||
SATSSPYIPQTAILYEPPANPTPTSHTPPSPSPAPPPPSPPARRTPPPRSRRTPPSSTPPAARCRSSSAAAPAPSASTGGRARLTESKLCFRCSFRPSTALCIST* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 10,829.102 | ||
Theoretical pI: | 11.382 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 106.979 | ||
aromaticity | 0.038 | ||
GRAVY | -0.664 | ||
Secondary Structure Fraction | |||
Helix | 0.105 | ||
turn | 0.457 | ||
sheet | 0.190 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338574.1 | internal | 234 | 3-704(+) |
Amino Acid sequence : | |||
THKESSDHLLQMRRPSIGLCVNHILLDGMSAKDFNENLASQAFDDKPLSVVPCFDRRLLAARSPPQPAFDHREFKPNLGPASTPPVFDCTKEHLEYRVFQLYPPHINLLKQKAKPESGRI SGLTAAAALMWKCKALSKDESYNGNRVSTLLNVLDLRSRLREPALPPNYCGNALLVAYSTAACGEIAAAEFAELAERVAAAPGRVTEEYARSALDWLEVHRGLPFGEYMVSSWL | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 10,829.102 | ||
Theoretical pI: | 11.382 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 106.979 | ||
aromaticity | 0.038 | ||
GRAVY | -0.664 | ||
Secondary Structure Fraction | |||
Helix | 0.105 | ||
turn | 0.457 | ||
sheet | 0.190 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338574.1 | complete | 119 | 391-32(-) |
Amino Acid sequence : | |||
MSAAAAVRPLIRPDSGLAFCLRRFMWGGYNWKTRYSRCSLVQSKTGGVEAGPRFGLNSRWSKAGCGGERAARRRRSKQGTTDKGLSSKACEARFSLKSLALIPSSKMWFTQSPMEGRRI* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 10,829.102 | ||
Theoretical pI: | 11.382 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 106.979 | ||
aromaticity | 0.038 | ||
GRAVY | -0.664 | ||
Secondary Structure Fraction | |||
Helix | 0.105 | ||
turn | 0.457 | ||
sheet | 0.190 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338574.1 | 5prime_partial | 105 | 705-388(-) |
Amino Acid sequence : | |||
SATSSPYIPQTAILYEPPANPTPTSHTPPSPSPAPPPPSPPARRTPPPRSRRTPPSSTPPAARCRSSSAAAPAPSASTGGRARLTESKLCFRCSFRPSTALCIST* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 10,829.102 | ||
Theoretical pI: | 11.382 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 106.979 | ||
aromaticity | 0.038 | ||
GRAVY | -0.664 | ||
Secondary Structure Fraction | |||
Helix | 0.105 | ||
turn | 0.457 | ||
sheet | 0.190 |