Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338577.1 | complete | 137 | 153-566(+) |
Amino Acid sequence : | |||
MAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQF SLHILKHSTIVLKPRSL* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 11,993.328 | ||
Theoretical pI: | 10.117 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 52.311 | ||
aromaticity | 0.019 | ||
GRAVY | -1.037 | ||
Secondary Structure Fraction | |||
Helix | 0.204 | ||
turn | 0.278 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338577.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
HAVLVNHPHIQKKLRDELDTVLGPGVQITEPDTHKALIPPGRDQGNSSSPYGDPTARAPHEPPRRQARWVRHPRGEQDLGERLVVGQQPRSMEKTRGVQAREILGRGG* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,993.328 | ||
Theoretical pI: | 10.117 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 52.311 | ||
aromaticity | 0.019 | ||
GRAVY | -1.037 | ||
Secondary Structure Fraction | |||
Helix | 0.204 | ||
turn | 0.278 | ||
sheet | 0.204 |