| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338577.1 | complete | 137 | 153-566(+) |
Amino Acid sequence : | |||
| MAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQF SLHILKHSTIVLKPRSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 11,993.328 | ||
| Theoretical pI: | 10.117 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 52.311 | ||
| aromaticity | 0.019 | ||
| GRAVY | -1.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.278 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338577.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
| HAVLVNHPHIQKKLRDELDTVLGPGVQITEPDTHKALIPPGRDQGNSSSPYGDPTARAPHEPPRRQARWVRHPRGEQDLGERLVVGQQPRSMEKTRGVQAREILGRGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,993.328 | ||
| Theoretical pI: | 10.117 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 52.311 | ||
| aromaticity | 0.019 | ||
| GRAVY | -1.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.278 | ||
| sheet | 0.204 | ||