| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338582.1 | internal | 243 | 3-731(+) |
Amino Acid sequence : | |||
| YICLIMASSLIFKVTRQKPELITPAKPTPHEFRPLSDIDDQKALRFHAIGIQFYRKNTFMEGKNPIEVIREAISKTLVFFYPFAGRLRECGSRKLVVDCTAEGVVFTGAYADSTMEQFGD ILRPPFPNLEELIYDVSGTCGVINCPLLLFQVTRLKCDGFIFAFRFNHTMCDAAGLLQFLSAVGELARGADAPSTPPVWDRHLLTARCPPCVPFTHREYALKPDTVAAIAGNLVERSFLF DAA | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 27,143.237 | ||
| Theoretical pI: | 7.086 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14940 | ||
| Instability index: | 37.635 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.198 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338582.1 | internal | 243 | 3-731(+) |
Amino Acid sequence : | |||
| YICLIMASSLIFKVTRQKPELITPAKPTPHEFRPLSDIDDQKALRFHAIGIQFYRKNTFMEGKNPIEVIREAISKTLVFFYPFAGRLRECGSRKLVVDCTAEGVVFTGAYADSTMEQFGD ILRPPFPNLEELIYDVSGTCGVINCPLLLFQVTRLKCDGFIFAFRFNHTMCDAAGLLQFLSAVGELARGADAPSTPPVWDRHLLTARCPPCVPFTHREYALKPDTVAAIAGNLVERSFLF DAA | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 27,143.237 | ||
| Theoretical pI: | 7.086 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14940 | ||
| Instability index: | 37.635 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.198 | ||
| sheet | 0.263 | ||