| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338584.1 | 5prime_partial | 147 | 2-445(+) |
Amino Acid sequence : | |||
| HEETITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED GRTLADYNIQKESTLHLVLRLRGGGDI* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 15,913.503 | ||
| Theoretical pI: | 7.943 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 59.484 | ||
| aromaticity | 0.066 | ||
| GRAVY | 0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.419 | ||
| turn | 0.162 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338584.1 | 3prime_partial | 136 | 409-2(-) |
Amino Acid sequence : | |||
| MQSRLFLDVIISQRTPILQLLPSKDQPLLIRWNAFLILDLRLHVINGVRALHLQSDRLSSQRLHEDLHSTTQPQHQMQGRLLLDIVVRQSPPIFQLFASEDQPLLIRWDSFLVLYLCLHV VDCIRALHFQRDGLLV | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 15,913.503 | ||
| Theoretical pI: | 7.943 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 59.484 | ||
| aromaticity | 0.066 | ||
| GRAVY | 0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.419 | ||
| turn | 0.162 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338584.1 | 5prime_partial | 147 | 2-445(+) |
Amino Acid sequence : | |||
| HEETITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED GRTLADYNIQKESTLHLVLRLRGGGDI* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 15,913.503 | ||
| Theoretical pI: | 7.943 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 59.484 | ||
| aromaticity | 0.066 | ||
| GRAVY | 0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.419 | ||
| turn | 0.162 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338584.1 | 3prime_partial | 136 | 409-2(-) |
Amino Acid sequence : | |||
| MQSRLFLDVIISQRTPILQLLPSKDQPLLIRWNAFLILDLRLHVINGVRALHLQSDRLSSQRLHEDLHSTTQPQHQMQGRLLLDIVVRQSPPIFQLFASEDQPLLIRWDSFLVLYLCLHV VDCIRALHFQRDGLLV | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 15,913.503 | ||
| Theoretical pI: | 7.943 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 59.484 | ||
| aromaticity | 0.066 | ||
| GRAVY | 0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.419 | ||
| turn | 0.162 | ||
| sheet | 0.272 | ||