Acc_NO	ORF type	length	start-end position (strand +/-)
>DY338586.1	5prime_partial	167	3-506(+)
Amino Acid sequence :
VSQEPVLFNCTIEENIAYGYEGKASESDIERGAEMANAHEFIMSFPEKYKTIVGERGLRLSGGQKQRIAIARALLMDPKVMLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLST VKSANTVAVIAEGQIAEIGTHDELLSRNGIYTALVRRQLQAPADEIS*
Physicochemical properties
Number of amino acids:		167
Molecular weight:		18,310.624
Theoretical pI:		4.925
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		7450 7450
Instability index:		43.941
aromaticity		0.048
GRAVY		-0.124
Secondary Structure Fraction
Helix		0.287
turn		0.192
sheet		0.353