Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338586.1 | 5prime_partial | 167 | 3-506(+) |
Amino Acid sequence : | |||
VSQEPVLFNCTIEENIAYGYEGKASESDIERGAEMANAHEFIMSFPEKYKTIVGERGLRLSGGQKQRIAIARALLMDPKVMLLDEATSALDAESEYLVQDAMDSLMRGRTVLVIAHRLST VKSANTVAVIAEGQIAEIGTHDELLSRNGIYTALVRRQLQAPADEIS* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 18,310.624 | ||
Theoretical pI: | 4.925 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 43.941 | ||
aromaticity | 0.048 | ||
GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.192 | ||
sheet | 0.353 |