| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338592.1 | internal | 206 | 2-619(+) |
Amino Acid sequence : | |||
| PPETVFQPLLKDNLIAKGLVLSLITDFFKEYLADNSLDDLIAILKRAKIKNNLLDFFPSPKRTPEAISEHFTKEGLLLLVDYNEKKMFEVKLKEMKNALTRQISEASAVTEVIETVKQYV KDAKFPHIDVVRIIWDVLMDAVQWSGKNHQQNANSALRQVKTWSELLNAFCTTGKLDLELISEAQIQCYEDAKLMKLFPDIIISLY | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 23,629.228 | ||
| Theoretical pI: | 5.719 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 29.048 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.160 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338592.1 | internal | 206 | 2-619(+) |
Amino Acid sequence : | |||
| PPETVFQPLLKDNLIAKGLVLSLITDFFKEYLADNSLDDLIAILKRAKIKNNLLDFFPSPKRTPEAISEHFTKEGLLLLVDYNEKKMFEVKLKEMKNALTRQISEASAVTEVIETVKQYV KDAKFPHIDVVRIIWDVLMDAVQWSGKNHQQNANSALRQVKTWSELLNAFCTTGKLDLELISEAQIQCYEDAKLMKLFPDIIISLY | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 23,629.228 | ||
| Theoretical pI: | 5.719 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 29.048 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.160 | ||
| sheet | 0.301 | ||