| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338594.1 | internal | 272 | 1-816(+) |
Amino Acid sequence : | |||
| APGLVPNSARGTMASSPPQSLESLVLQLHDIAAVKFGNFKLKSGIFSPIYIDLRLIVSYPSLLRQISQTIAATVPSSARYDVVCGVPYTALPIATCISVASDVPMLMRRKEVKDYGTAKA IEGAFQPNQVCLIVEDLVTSGASVLETAAPLRAVGLKVTDAVVMIDREQGGRENLAQNGITLHSMVKLTEMVKILKEKGRVSEETEKMVIKFLEENRQVSVPSAAVVDKKPKVGLPFEER AKMAKNPTGRKLFEIMVKKQSNLCLAADVTTA | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 14,060.239 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 109.441 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.055 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.250 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338594.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
| HQVSCRIRHEAQWHPRHPNPWSRWCCSSTTSPPSNSATSSSNPAYSLQSTSTSASSSPTLPCSAKSPKPSPPPSPPPPDTTSSAASPTPPYPSPPASPSPPMSPCSCAARRSRTTAPPRP LKALFSRIKSASLLRISLLAALPFSRRRRRSVPSG* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 14,060.239 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 109.441 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.055 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.250 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338594.1 | 5prime_partial | 120 | 3-365(+) |
Amino Acid sequence : | |||
| TRSRAEFGTRHNGILATPILGVAGAAAPRHRRRQIRQLQAQIRHILSNLHRPPPHRLLPFPAPPNLPNHRRHRPLLRPIRRRLRRPLHRPTHRHLHLRRLRCPHAHAPQGGQGLRHRQGH * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 14,060.239 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 109.441 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.055 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.250 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338594.1 | internal | 272 | 1-816(+) |
Amino Acid sequence : | |||
| APGLVPNSARGTMASSPPQSLESLVLQLHDIAAVKFGNFKLKSGIFSPIYIDLRLIVSYPSLLRQISQTIAATVPSSARYDVVCGVPYTALPIATCISVASDVPMLMRRKEVKDYGTAKA IEGAFQPNQVCLIVEDLVTSGASVLETAAPLRAVGLKVTDAVVMIDREQGGRENLAQNGITLHSMVKLTEMVKILKEKGRVSEETEKMVIKFLEENRQVSVPSAAVVDKKPKVGLPFEER AKMAKNPTGRKLFEIMVKKQSNLCLAADVTTA | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 14,060.239 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 109.441 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.055 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.250 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338594.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
| HQVSCRIRHEAQWHPRHPNPWSRWCCSSTTSPPSNSATSSSNPAYSLQSTSTSASSSPTLPCSAKSPKPSPPPSPPPPDTTSSAASPTPPYPSPPASPSPPMSPCSCAARRSRTTAPPRP LKALFSRIKSASLLRISLLAALPFSRRRRRSVPSG* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 14,060.239 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 109.441 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.055 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.250 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338594.1 | 5prime_partial | 120 | 3-365(+) |
Amino Acid sequence : | |||
| TRSRAEFGTRHNGILATPILGVAGAAAPRHRRRQIRQLQAQIRHILSNLHRPPPHRLLPFPAPPNLPNHRRHRPLLRPIRRRLRRPLHRPTHRHLHLRRLRCPHAHAPQGGQGLRHRQGH * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 14,060.239 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 109.441 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.055 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.250 | ||
| sheet | 0.225 | ||