| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338597.1 | internal | 256 | 2-769(+) |
Amino Acid sequence : | |||
| HHVIIFPFLLTRILHNQLWISYSRYRTAKGTSRIVDKNIEFDQVDREKNWDDQIIFNGLLFYLGYSYIKEAHHLPFWRTDGVIWTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSS IVTEPITSVIHPFGEHIAYFALFAIPLLTTIWTRTASMTSFAGYITYIDFMNNMGHCNFEHIPKRLFSIFPPLKYLIYTPSYHSLHHTQFRTNYSLFMPFYDYVYGTMDKSSDSLYESSL VRKEDVPDVVHLTHLT | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 14,614.813 | ||
| Theoretical pI: | 9.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 70.539 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.283 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338597.1 | complete | 127 | 250-633(+) |
Amino Acid sequence : | |||
| MDNFASCWSSRVPLLLAPPRPPPPLPLLPLPFPPPLLHRHRAHYVGDPSLRRTHSILRPLRDPITDNDMDSNCFDDLVRRLYNLHRFYEQHGPLQLRAHSKTTLLHLPSLKISHLHTFIS LAAPHSI* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,614.813 | ||
| Theoretical pI: | 9.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 70.539 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.283 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338597.1 | internal | 256 | 2-769(+) |
Amino Acid sequence : | |||
| HHVIIFPFLLTRILHNQLWISYSRYRTAKGTSRIVDKNIEFDQVDREKNWDDQIIFNGLLFYLGYSYIKEAHHLPFWRTDGVIWTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSS IVTEPITSVIHPFGEHIAYFALFAIPLLTTIWTRTASMTSFAGYITYIDFMNNMGHCNFEHIPKRLFSIFPPLKYLIYTPSYHSLHHTQFRTNYSLFMPFYDYVYGTMDKSSDSLYESSL VRKEDVPDVVHLTHLT | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 14,614.813 | ||
| Theoretical pI: | 9.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 70.539 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.283 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338597.1 | complete | 127 | 250-633(+) |
Amino Acid sequence : | |||
| MDNFASCWSSRVPLLLAPPRPPPPLPLLPLPFPPPLLHRHRAHYVGDPSLRRTHSILRPLRDPITDNDMDSNCFDDLVRRLYNLHRFYEQHGPLQLRAHSKTTLLHLPSLKISHLHTFIS LAAPHSI* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,614.813 | ||
| Theoretical pI: | 9.877 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 70.539 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.283 | ||
| sheet | 0.252 | ||