| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338615.1 | 3prime_partial | 163 | 165-653(+) |
Amino Acid sequence : | |||
| MNRILSPKASCISFKDSACRCFGFLVSNKKDIFTIDDDCFVAKDPTGKDIDALSQHIQNLLTPSTPFFFNTLYDPYTEGADFVRGNPFILREGVPTAVSHGLWLDIPDYDAPTQLVKSRK RNTRYVDAVLTIPKGTLFPMCGMNLAFDRDLSGPGMYFGLMSD | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 11,030.966 | ||
| Theoretical pI: | 4.431 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 56.715 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.359 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.235 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338615.1 | 5prime_partial | 102 | 653-345(-) |
Amino Acid sequence : | |||
| ITHEPEIHARATQISIKRKIHPTHWEQSALRDCEDSINIPSVALARFDELSGGIVVGDVEPEAVGDSGRDTFPQDEGVTTDEVSAFSVGIVECVEEEGCGRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,030.966 | ||
| Theoretical pI: | 4.431 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 56.715 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.359 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.235 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338615.1 | 3prime_partial | 163 | 165-653(+) |
Amino Acid sequence : | |||
| MNRILSPKASCISFKDSACRCFGFLVSNKKDIFTIDDDCFVAKDPTGKDIDALSQHIQNLLTPSTPFFFNTLYDPYTEGADFVRGNPFILREGVPTAVSHGLWLDIPDYDAPTQLVKSRK RNTRYVDAVLTIPKGTLFPMCGMNLAFDRDLSGPGMYFGLMSD | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 11,030.966 | ||
| Theoretical pI: | 4.431 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 56.715 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.359 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.235 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338615.1 | 5prime_partial | 102 | 653-345(-) |
Amino Acid sequence : | |||
| ITHEPEIHARATQISIKRKIHPTHWEQSALRDCEDSINIPSVALARFDELSGGIVVGDVEPEAVGDSGRDTFPQDEGVTTDEVSAFSVGIVECVEEEGCGRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,030.966 | ||
| Theoretical pI: | 4.431 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 56.715 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.359 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.235 | ||
| sheet | 0.225 | ||