| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338616.1 | 5prime_partial | 183 | 1-552(+) |
Amino Acid sequence : | |||
| APVSRLVAHVLTKDYHHVIDGIRTLVDVGGGNGTMAKAIVEAMPTMKCTVLDLPHVVAGLESTDKLSYIGGDMFQSIPSADAILLKFIIHDWDDEEGLKILKRCKDAVGIGGKVIIIDVV VGVNHDVDEVLEDQLHFDMAMMCYFNAKERTMNEWEKLISDAGFTSYKLTPAFGVRSLIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 20,119.086 | ||
| Theoretical pI: | 5.032 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 28.716 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.158 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.180 | ||
| sheet | 0.262 | ||