| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338622.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| APVKNLSCSSLEVDELADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIA QGVHGHLTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPAKYL DEKTIFHLNPSGRFV | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 15,819.231 | ||
| Theoretical pI: | 6.697 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 20.129 | ||
| aromaticity | 0.034 | ||
| GRAVY | 0.383 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.215 | ||
| sheet | 0.309 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338622.1 | complete | 149 | 474-25(-) |
Amino Acid sequence : | |||
| MTKRHVLRGFVSGVPKHVALVTGPDLLRAFGQMAVNALSDIRALLLDVDKNLALVSIETNVVGNKPYRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRQFVDLER* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 15,819.231 | ||
| Theoretical pI: | 6.697 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 20.129 | ||
| aromaticity | 0.034 | ||
| GRAVY | 0.383 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.215 | ||
| sheet | 0.309 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338622.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| APVKNLSCSSLEVDELADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIA QGVHGHLTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPAKYL DEKTIFHLNPSGRFV | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 15,819.231 | ||
| Theoretical pI: | 6.697 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 20.129 | ||
| aromaticity | 0.034 | ||
| GRAVY | 0.383 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.215 | ||
| sheet | 0.309 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338622.1 | complete | 149 | 474-25(-) |
Amino Acid sequence : | |||
| MTKRHVLRGFVSGVPKHVALVTGPDLLRAFGQMAVNALSDIRALLLDVDKNLALVSIETNVVGNKPYRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRQFVDLER* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 15,819.231 | ||
| Theoretical pI: | 6.697 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 20.129 | ||
| aromaticity | 0.034 | ||
| GRAVY | 0.383 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.215 | ||
| sheet | 0.309 | ||