| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338625.1 | internal | 226 | 3-680(+) |
Amino Acid sequence : | |||
| TLLINPRPQKPDHPISADFSAFPTMRNAQRVLEKIATAAFTLGIGGAAASSCLYTVDGGQRAVIFDRFQGVKPNTVGEGTHFLIPWLQKPFIFEIRTRPHTFSSMSGTKDLQMVNLTLRV LSRPDVSRLPDIFKTLGLDYDERVLPSIGNEVLKAVVAQFNADQLLTERPRVSAFVRESLIRRAKDFNIVLDDVAITHLSYGAEFSRAVEQKQVAQQEAERSKFVV | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 25,212.628 | ||
| Theoretical pI: | 9.329 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 34.222 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.208 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338625.1 | internal | 226 | 3-680(+) |
Amino Acid sequence : | |||
| TLLINPRPQKPDHPISADFSAFPTMRNAQRVLEKIATAAFTLGIGGAAASSCLYTVDGGQRAVIFDRFQGVKPNTVGEGTHFLIPWLQKPFIFEIRTRPHTFSSMSGTKDLQMVNLTLRV LSRPDVSRLPDIFKTLGLDYDERVLPSIGNEVLKAVVAQFNADQLLTERPRVSAFVRESLIRRAKDFNIVLDDVAITHLSYGAEFSRAVEQKQVAQQEAERSKFVV | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 25,212.628 | ||
| Theoretical pI: | 9.329 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 34.222 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.119 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.208 | ||
| sheet | 0.243 | ||