| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338626.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| DLTTALQQMSVPDLMLSGRSLTFRSCLPLLLVHSHRLWSSEECACEFKDNKISKEDYIKAIKEEINKVVKLQEQLDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP IIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFGRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVWSSRHHPDPH AHVLLHFHDLIHSII | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 29,174.104 | ||
| Theoretical pI: | 6.058 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 42190 | ||
| Instability index: | 45.951 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.204 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338626.1 | internal | 255 | 1-765(+) |
Amino Acid sequence : | |||
| DLTTALQQMSVPDLMLSGRSLTFRSCLPLLLVHSHRLWSSEECACEFKDNKISKEDYIKAIKEEINKVVKLQEQLDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPP IIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFGRNDQPRFETCYQIALAIKDEVEDLEKAGITVIQIDEAALREGLPLRKSEHAFYLDWAVHSFRITNVWSSRHHPDPH AHVLLHFHDLIHSII | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 29,174.104 | ||
| Theoretical pI: | 6.058 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 42190 | ||
| Instability index: | 45.951 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.204 | ||
| sheet | 0.255 | ||