Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338627.1 | 5prime_partial | 143 | 642-211(-) |
Amino Acid sequence : | |||
GPKMSKRGRGGTAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAI TGPIGKECADLWPRIASAANAIV* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 10,777.767 | ||
Theoretical pI: | 9.514 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 49.728 | ||
aromaticity | 0.109 | ||
GRAVY | 0.720 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.267 | ||
sheet | 0.287 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338627.1 | complete | 101 | 218-523(+) |
Amino Acid sequence : | |||
MALAALAILGHKSAHSFPIGPVIAEPFISPLGFTITPALSSKYMKTPSFRLQGFRCLTMTAGMTFFLKSGFPFFTVAITISPTQADGSLLSLPLIPLTDIM* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,777.767 | ||
Theoretical pI: | 9.514 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 49.728 | ||
aromaticity | 0.109 | ||
GRAVY | 0.720 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.267 | ||
sheet | 0.287 |