Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338653.1 | 5prime_partial | 121 | 1-366(+) |
Amino Acid sequence : | |||
APVKGSSVVFVSSIARFQPPKGLAMYGVTKTALLGLTKALAAEMAPDTRVNCVAPGFVPTNFASFLTSNEQMKQSLEDKTLLQRLGTAQDMAAAAAYLASDDASYVTGETLVVAGGMPSR L* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 12,571.358 | ||
Theoretical pI: | 8.115 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 37.444 | ||
aromaticity | 0.066 | ||
GRAVY | 0.212 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.240 | ||
sheet | 0.339 |