Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338664.1 | complete | 188 | 41-607(+) |
Amino Acid sequence : | |||
MAMASPKFSALALLLLLPLLVQGNIECEKLREDRCAYAVSWSGKRCVLEKQVRRSGAEEYACTTSEIQANKLQNLIESDDCIKACGLERSALGISSDSLLEARFAKQLCSKACYRSCPNI VDLYFNLAAGEGVYLPKFCEAQGANARREMAEMKSSGLVSADSPLSQYDNSFYLAHAHAPAYAFAPSS* | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 20,494.246 | ||
Theoretical pI: | 6.149 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 18045 | ||
Instability index: | 76.527 | ||
aromaticity | 0.080 | ||
GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.234 | ||
sheet | 0.362 |