Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338697.1 | internal | 273 | 2-820(+) |
Amino Acid sequence : | |||
HQSPFLTSNPALLAQLMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSA AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPSKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLF PAINVNDSVPKSKFDNLYGCRHSLPDGLMKATD | |||
Physicochemical properties | |||
Number of amino acids: | 273 | ||
Molecular weight: | 27,177.476 | ||
Theoretical pI: | 5.389 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 44.011 | ||
aromaticity | 0.011 | ||
GRAVY | 0.055 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.276 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338697.1 | 5prime_partial | 261 | 820-35(-) |
Amino Acid sequence : | |||
ISSLHKSIGQRVPATVQVIELALGDRIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILAGIGLQPVSDQRQHYLKLRIIGRAGVRQLPRLLVLLLRLHALVDQQSSITAIV HDEVGAAARAPVEGPLRAPPVLLQGLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLNEDGSLDGHVETSGDPGALEGLGGAELGPAGNEARHLHLSELDFEAAEVGLGHV LDLVLAAGGGLLHLERHELSE* | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 27,177.476 | ||
Theoretical pI: | 5.389 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 44.011 | ||
aromaticity | 0.011 | ||
GRAVY | 0.055 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.276 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338697.1 | internal | 273 | 2-820(+) |
Amino Acid sequence : | |||
HQSPFLTSNPALLAQLMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSA AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPSKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLF PAINVNDSVPKSKFDNLYGCRHSLPDGLMKATD | |||
Physicochemical properties | |||
Number of amino acids: | 273 | ||
Molecular weight: | 27,177.476 | ||
Theoretical pI: | 5.389 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 44.011 | ||
aromaticity | 0.011 | ||
GRAVY | 0.055 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.276 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338697.1 | 5prime_partial | 261 | 820-35(-) |
Amino Acid sequence : | |||
ISSLHKSIGQRVPATVQVIELALGDRIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILAGIGLQPVSDQRQHYLKLRIIGRAGVRQLPRLLVLLLRLHALVDQQSSITAIV HDEVGAAARAPVEGPLRAPPVLLQGLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLNEDGSLDGHVETSGDPGALEGLGGAELGPAGNEARHLHLSELDFEAAEVGLGHV LDLVLAAGGGLLHLERHELSE* | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 27,177.476 | ||
Theoretical pI: | 5.389 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 44.011 | ||
aromaticity | 0.011 | ||
GRAVY | 0.055 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.276 | ||
sheet | 0.337 |