Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338704.1 | complete | 128 | 153-539(+) |
Amino Acid sequence : | |||
MMCACRRHPLGSAANQVARMPPLLGGSPRLRTLLVGFEDHSQTRKLSSQLPVTPASIWHPAIEHEFQAHLLLHVRLTVHSQVQGAFWMCLVRCISFFQQLEVVEQATETQIQEANFEVGF QLQNNSSE* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,446.438 | ||
Theoretical pI: | 6.643 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
Instability index: | 54.565 | ||
aromaticity | 0.070 | ||
GRAVY | -0.095 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.211 | ||
sheet | 0.297 |