| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338704.1 | complete | 128 | 153-539(+) |
Amino Acid sequence : | |||
| MMCACRRHPLGSAANQVARMPPLLGGSPRLRTLLVGFEDHSQTRKLSSQLPVTPASIWHPAIEHEFQAHLLLHVRLTVHSQVQGAFWMCLVRCISFFQQLEVVEQATETQIQEANFEVGF QLQNNSSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,446.438 | ||
| Theoretical pI: | 6.643 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 54.565 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.095 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.211 | ||
| sheet | 0.297 | ||