| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338705.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
| TSRLSIALEILVRPRILFLDEPTTGLDSAASFFVIQAIKNLARDGRTVISSIHQPSSEVFALFDDLFLLSGGESVYFGEAKKAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDVVTATLR GSQRYHETNVASSDPFMNLATSDINSVLIEKYKHSEYAKRTSLKIGEMSNSQGGDIETVKGSHASWWKQLSTLTRRSFVNMSRDVGYYWSRIVIYILVSICVGTLFYDVGTSYTAIFARG ACGGFVTGFLT | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 11,305.697 | ||
| Theoretical pI: | 9.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 27.907 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.282 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338705.1 | 3prime_partial | 103 | 311-3(-) |
Amino Acid sequence : | |||
| MIGWISPAGTWKSCFCKKLYRLLSFSKINRFATRQKKEVIKESKDLTAGLMYRGDNSSSITSKILDSLNDEEGGRTIKASSGLIQKQNTGANQNLEGDAEATG | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,305.697 | ||
| Theoretical pI: | 9.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 27.907 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.282 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338705.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
| TSRLSIALEILVRPRILFLDEPTTGLDSAASFFVIQAIKNLARDGRTVISSIHQPSSEVFALFDDLFLLSGGESVYFGEAKKAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDVVTATLR GSQRYHETNVASSDPFMNLATSDINSVLIEKYKHSEYAKRTSLKIGEMSNSQGGDIETVKGSHASWWKQLSTLTRRSFVNMSRDVGYYWSRIVIYILVSICVGTLFYDVGTSYTAIFARG ACGGFVTGFLT | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 11,305.697 | ||
| Theoretical pI: | 9.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 27.907 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.282 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338705.1 | 3prime_partial | 103 | 311-3(-) |
Amino Acid sequence : | |||
| MIGWISPAGTWKSCFCKKLYRLLSFSKINRFATRQKKEVIKESKDLTAGLMYRGDNSSSITSKILDSLNDEEGGRTIKASSGLIQKQNTGANQNLEGDAEATG | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,305.697 | ||
| Theoretical pI: | 9.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 27.907 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.282 | ||
| sheet | 0.233 | ||