Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338705.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
TSRLSIALEILVRPRILFLDEPTTGLDSAASFFVIQAIKNLARDGRTVISSIHQPSSEVFALFDDLFLLSGGESVYFGEAKKAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDVVTATLR GSQRYHETNVASSDPFMNLATSDINSVLIEKYKHSEYAKRTSLKIGEMSNSQGGDIETVKGSHASWWKQLSTLTRRSFVNMSRDVGYYWSRIVIYILVSICVGTLFYDVGTSYTAIFARG ACGGFVTGFLT | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 11,305.697 | ||
Theoretical pI: | 9.392 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 27.907 | ||
aromaticity | 0.068 | ||
GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.282 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338705.1 | 3prime_partial | 103 | 311-3(-) |
Amino Acid sequence : | |||
MIGWISPAGTWKSCFCKKLYRLLSFSKINRFATRQKKEVIKESKDLTAGLMYRGDNSSSITSKILDSLNDEEGGRTIKASSGLIQKQNTGANQNLEGDAEATG | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,305.697 | ||
Theoretical pI: | 9.392 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 27.907 | ||
aromaticity | 0.068 | ||
GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.282 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338705.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
TSRLSIALEILVRPRILFLDEPTTGLDSAASFFVIQAIKNLARDGRTVISSIHQPSSEVFALFDDLFLLSGGESVYFGEAKKAVKFFAEAGFPCPSRRNPSDHFLRCINSDFDVVTATLR GSQRYHETNVASSDPFMNLATSDINSVLIEKYKHSEYAKRTSLKIGEMSNSQGGDIETVKGSHASWWKQLSTLTRRSFVNMSRDVGYYWSRIVIYILVSICVGTLFYDVGTSYTAIFARG ACGGFVTGFLT | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 11,305.697 | ||
Theoretical pI: | 9.392 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 27.907 | ||
aromaticity | 0.068 | ||
GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.282 | ||
sheet | 0.233 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338705.1 | 3prime_partial | 103 | 311-3(-) |
Amino Acid sequence : | |||
MIGWISPAGTWKSCFCKKLYRLLSFSKINRFATRQKKEVIKESKDLTAGLMYRGDNSSSITSKILDSLNDEEGGRTIKASSGLIQKQNTGANQNLEGDAEATG | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,305.697 | ||
Theoretical pI: | 9.392 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 27.907 | ||
aromaticity | 0.068 | ||
GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.282 | ||
sheet | 0.233 |