| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338729.1 | complete | 175 | 14-541(+) |
Amino Acid sequence : | |||
| MAAADVQFRCFVGGLAWATTDQSLEQAFSQYGQVTESKIINDRETGRSRGFGFVTFRDEQSMRDAIDAMNGQDLDGRNITVNEAQSRGGGGGGFRGPRRDGGGNGGGYGRRENSCGGNGG GYGGDSGGYGGYGGGYGSSRSGGGYGGSRSGGGGYGGERGYSSRSGGSAEGSWRN* | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 11,438.315 | ||
| Theoretical pI: | 4.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 12.256 | ||
| aromaticity | 0.027 | ||
| GRAVY | 1.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.382 | ||
| turn | 0.100 | ||
| sheet | 0.355 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338729.1 | complete | 110 | 222-554(+) |
Amino Acid sequence : | |||
| MVRIWTDVTSPSTRLSLVVEAAVDSVALAVMEAATVVVTVAVRIVVEGTVEDTVATVEDMVVMEAVMVAAAAAVVTVVAAAEVVVMVANVATPRGVVDLPREAGEIRFRF* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 11,438.315 | ||
| Theoretical pI: | 4.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 12.256 | ||
| aromaticity | 0.027 | ||
| GRAVY | 1.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.382 | ||
| turn | 0.100 | ||
| sheet | 0.355 | ||