| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338743.1 | internal | 257 | 1-771(+) |
Amino Acid sequence : | |||
| APVQVMRIADQGADILRITVQGKKEADACFDKKNTLVQKNYNIPLVADIHFAPAVALRVAECFDKIRVNPGNFADRRAQFEQLEYTDDDYQKELEHIEKVFTPLVEKCKKYGRAMRIGTN HGSLSDRIMSFYGDSPRGMVESAFEYARICRKLDFHNFVFSMKASNPVIMVQAYRLLAAEMNVLGWDYPLHLGVTEAGEGEDGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEIDPCRR LANLGMKTSELQKGVTP | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 13,670.126 | ||
| Theoretical pI: | 9.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11500 | ||
| Instability index: | 24.727 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.505 | ||
Secondary Structure Fraction | |||
| Helix | 0.405 | ||
| turn | 0.256 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338743.1 | 3prime_partial | 121 | 363-1(-) |
Amino Acid sequence : | |||
| MVCPNAHCSAILLAFFNQWGENLLNMLKFFLVVVICVFQLLKLCPPISKVSRVNTDFIKTFSNSQSNSWSKVNVCHQRDVVVLLNKGVLFIKTCIRFLLSLHSDSKNICSLICNSHNLHG C | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,670.126 | ||
| Theoretical pI: | 9.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11500 | ||
| Instability index: | 24.727 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.505 | ||
Secondary Structure Fraction | |||
| Helix | 0.405 | ||
| turn | 0.256 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338743.1 | internal | 257 | 1-771(+) |
Amino Acid sequence : | |||
| APVQVMRIADQGADILRITVQGKKEADACFDKKNTLVQKNYNIPLVADIHFAPAVALRVAECFDKIRVNPGNFADRRAQFEQLEYTDDDYQKELEHIEKVFTPLVEKCKKYGRAMRIGTN HGSLSDRIMSFYGDSPRGMVESAFEYARICRKLDFHNFVFSMKASNPVIMVQAYRLLAAEMNVLGWDYPLHLGVTEAGEGEDGRMKSAIGIGTLLMDGLGDTIRVSLTEPPEEEIDPCRR LANLGMKTSELQKGVTP | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 13,670.126 | ||
| Theoretical pI: | 9.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11500 | ||
| Instability index: | 24.727 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.505 | ||
Secondary Structure Fraction | |||
| Helix | 0.405 | ||
| turn | 0.256 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338743.1 | 3prime_partial | 121 | 363-1(-) |
Amino Acid sequence : | |||
| MVCPNAHCSAILLAFFNQWGENLLNMLKFFLVVVICVFQLLKLCPPISKVSRVNTDFIKTFSNSQSNSWSKVNVCHQRDVVVLLNKGVLFIKTCIRFLLSLHSDSKNICSLICNSHNLHG C | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,670.126 | ||
| Theoretical pI: | 9.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11500 | ||
| Instability index: | 24.727 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.505 | ||
Secondary Structure Fraction | |||
| Helix | 0.405 | ||
| turn | 0.256 | ||
| sheet | 0.190 | ||