Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338761.1 | 5prime_partial | 163 | 629-138(-) |
Amino Acid sequence : | |||
HVIAAGLNGYMATVTNLKNPVNKGRCGAAPITAMLTVKRYGRGHGDTNLGRPALHPATVDLKGKAYELLRQNATKFLLDDVYRNPGPFQFDGPGADSKPVFLCVEDQDYMGRIKKLQEYL DKVRSIVKPGCSQDVLKAALSAMASVTDILSVISTPTSGNIPI* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 15,521.859 | ||
Theoretical pI: | 11.223 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 47.449 | ||
aromaticity | 0.112 | ||
GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.239 | ||
sheet | 0.179 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338761.1 | complete | 134 | 123-527(+) |
Amino Acid sequence : | |||
MRKFNLYGDISTGRGRNHRQNVSYRSHGAQSSFENILRASRFHNRADLVQVFLQFLYPTHVVLIFHAQKNRLGVGTWAIKLKRSWISVYVVQQKLGCILPQQLISLSLQINSRWMQSWSP KICITMTTAIAFNS* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,521.859 | ||
Theoretical pI: | 11.223 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 47.449 | ||
aromaticity | 0.112 | ||
GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.239 | ||
sheet | 0.179 |