| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338768.1 | internal | 243 | 1-729(+) |
Amino Acid sequence : | |||
| ICMPPCLQASSLSFPLLRRHSRNNLINKFRNPSLPRIDIPRQNIDLKTFAAITPTVAWPPSEPEIIPEKKEDKFEWYENWYPVATVCDLDKRRPHGKKVIGIDVVVWWDRKENAWKVFDD TCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIYLTKKPHYIPELDDPSFTCTMTTREVPYGYEILAENLM DPS | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 28,108.014 | ||
| Theoretical pI: | 8.295 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 68410 69035 | ||
| Instability index: | 51.581 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.517 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.247 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338768.1 | internal | 243 | 1-729(+) |
Amino Acid sequence : | |||
| ICMPPCLQASSLSFPLLRRHSRNNLINKFRNPSLPRIDIPRQNIDLKTFAAITPTVAWPPSEPEIIPEKKEDKFEWYENWYPVATVCDLDKRRPHGKKVIGIDVVVWWDRKENAWKVFDD TCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIYLTKKPHYIPELDDPSFTCTMTTREVPYGYEILAENLM DPS | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 28,108.014 | ||
| Theoretical pI: | 8.295 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 68410 69035 | ||
| Instability index: | 51.581 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.517 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.247 | ||
| sheet | 0.177 | ||