Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338789.1 | 3prime_partial | 160 | 482-3(-) |
Amino Acid sequence : | |||
MVLLLNISIITVGKIMHSEDLPVYPFPWALQWQLALLVQPLHQCSAQGLHQHSQPLGLEVHRLGLELARSVREKRVLLASALALSLSAGKNDQGIPSFSSHQQTVEPGLRALEVLLAVAF SLSSRLQLQHIHSKPFASLLNQYDQTWDHSTLQLPVTITG | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 14,590.140 | ||
Theoretical pI: | 5.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 62.601 | ||
aromaticity | 0.022 | ||
GRAVY | -1.049 | ||
Secondary Structure Fraction | |||
Helix | 0.103 | ||
turn | 0.265 | ||
sheet | 0.360 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338789.1 | complete | 136 | 29-439(+) |
Amino Acid sequence : | |||
MSNDPKFDHIDLAEKQKVLNECVEAEAWMREKKQQQEALPKHANPALLSADVRKKMESLDRFCRPIMTKPKPKPAKPASPEPTSPAPAQGGEPQAQAAENAGASPEQNTDAGAGQEAPAA TAEPMETDKPEGPQNA* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 14,590.140 | ||
Theoretical pI: | 5.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 62.601 | ||
aromaticity | 0.022 | ||
GRAVY | -1.049 | ||
Secondary Structure Fraction | |||
Helix | 0.103 | ||
turn | 0.265 | ||
sheet | 0.360 |