| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338795.1 | 5prime_partial | 135 | 3-410(+) |
Amino Acid sequence : | |||
| TRLQSPSKQFHPTLIFSPHSQLMASILQASLLFFFLLVSTLALEAVAARDIPTDARIQPEMSFDGTVWVPGLGRYYIPRKGTKSLDYNPITGSPGGNGVSIPGITGSAGTHTTIPGGDDT TLPNPIGGAVPSPHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 11,154.911 | ||
| Theoretical pI: | 9.925 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 72.247 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.047 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.301 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338795.1 | complete | 103 | 193-504(+) |
Amino Acid sequence : | |||
| MARSGSRASAVTTSLERAQSLWTTTPSPVPPVATACPFLGSLARLAPTPPFPAEMTPRCPTLSVEPFPHRTLELRLRGQWWGNLCFLLGGLQARSCCFKSSLL* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,154.911 | ||
| Theoretical pI: | 9.925 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 72.247 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.047 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.301 | ||
| sheet | 0.301 | ||