| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338805.1 | internal | 268 | 3-806(+) |
Amino Acid sequence : | |||
| TRGSHFFADEEAMGTMNEGEIMEMDERRDEDGVGELYAGACSLSWKDLSVMITLRNGKPHKILDRISGYAEAGTLTALIGPSGSGKTTLLDALAGRLAPDTFVSGAILLNGRKAKLSFGT VAYVTQDENLIGTLTVRETIAYSARLRLPDSTPLSERNSIIENTILEMGLEECADTVIGNWHLRGISGGERRRVSIAIELLMRPRLLFLDEPTSGLDSAAAFFVTQTLRGLANGKRTVIA SIHQPSSEVFELFDRLCLLSGGRTVYFG | |||
Physicochemical properties | |||
| Number of amino acids: | 268 | ||
| Molecular weight: | 13,664.909 | ||
| Theoretical pI: | 5.291 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 53.780 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338805.1 | complete | 133 | 607-206(-) |
Amino Acid sequence : | |||
| MRSSMAMLTRRLSPPLMPRRCQFPMTVSAHSSSPISRIVFSMMEFLSDSGVLSGRRSRAEYAIVSRTVRVPIRFSSCVTYATVPKDNLALRPLRRMAPETKVSGARRPAKASRSVVLPEP EGPMRAVRVPASA* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 13,664.909 | ||
| Theoretical pI: | 5.291 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 53.780 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338805.1 | 5prime_partial | 125 | 806-429(-) |
Amino Acid sequence : | |||
| AKVDRSAPGQQAQSIKQFKNLTAWLVDRGYNGPFTVSQSPQRLSHEKCCRAVKSASWLVEEEEPWPHEELYGDADAAPLTAADAAQVPVSDDGVGTLFQSHLQNRVFDDGVSLRQRSTVG KAEPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,664.909 | ||
| Theoretical pI: | 5.291 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 53.780 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338805.1 | internal | 268 | 3-806(+) |
Amino Acid sequence : | |||
| TRGSHFFADEEAMGTMNEGEIMEMDERRDEDGVGELYAGACSLSWKDLSVMITLRNGKPHKILDRISGYAEAGTLTALIGPSGSGKTTLLDALAGRLAPDTFVSGAILLNGRKAKLSFGT VAYVTQDENLIGTLTVRETIAYSARLRLPDSTPLSERNSIIENTILEMGLEECADTVIGNWHLRGISGGERRRVSIAIELLMRPRLLFLDEPTSGLDSAAAFFVTQTLRGLANGKRTVIA SIHQPSSEVFELFDRLCLLSGGRTVYFG | |||
Physicochemical properties | |||
| Number of amino acids: | 268 | ||
| Molecular weight: | 13,664.909 | ||
| Theoretical pI: | 5.291 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 53.780 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338805.1 | complete | 133 | 607-206(-) |
Amino Acid sequence : | |||
| MRSSMAMLTRRLSPPLMPRRCQFPMTVSAHSSSPISRIVFSMMEFLSDSGVLSGRRSRAEYAIVSRTVRVPIRFSSCVTYATVPKDNLALRPLRRMAPETKVSGARRPAKASRSVVLPEP EGPMRAVRVPASA* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 13,664.909 | ||
| Theoretical pI: | 5.291 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 53.780 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338805.1 | 5prime_partial | 125 | 806-429(-) |
Amino Acid sequence : | |||
| AKVDRSAPGQQAQSIKQFKNLTAWLVDRGYNGPFTVSQSPQRLSHEKCCRAVKSASWLVEEEEPWPHEELYGDADAAPLTAADAAQVPVSDDGVGTLFQSHLQNRVFDDGVSLRQRSTVG KAEPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,664.909 | ||
| Theoretical pI: | 5.291 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 53.780 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||