Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338808.1 | 5prime_partial | 109 | 1-330(+) |
Amino Acid sequence : | |||
APVFPETNSGIIVLAQGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERKSGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPLHYRY* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,796.615 | ||
Theoretical pI: | 9.403 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
Instability index: | 56.315 | ||
aromaticity | 0.138 | ||
GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.229 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338808.1 | complete | 109 | 182-511(+) |
Amino Acid sequence : | |||
MCCRSTWMRRWQHFTWESWGPSSLSSPRIRLITSVFRWRDLTSLFTTDTDHNKQALSAICHCASLLLFEFSCHLGTPILWPIITKNIFSFASLLFHTNTTGISRHHWVN* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,796.615 | ||
Theoretical pI: | 9.403 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38500 38750 | ||
Instability index: | 56.315 | ||
aromaticity | 0.138 | ||
GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
Helix | 0.339 | ||
turn | 0.229 | ||
sheet | 0.183 |