Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338820.1 | complete | 113 | 34-375(+) |
Amino Acid sequence : | |||
MFESLPKADAVMLMWVLHDWSDPKCIEILKKCKEAIPTSTGKVMIVDAIINQEGEGDEFLGAPLTVDMTMMAMTTLGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,776.864 | ||
Theoretical pI: | 5.130 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 26.234 | ||
aromaticity | 0.080 | ||
GRAVY | -0.015 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.168 | ||
sheet | 0.319 |