| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338825.1 | 3prime_partial | 162 | 32-517(+) |
Amino Acid sequence : | |||
| MAAVNCAIDLQIADILEGHGGAMSLSELSSATGCSPSTLRRIMRYLIHRGFFKQEESTSSISYAQTPLSRLLLQQGDESMAAYFLLQNSPVMVDRWVKLSSRTLTNQSPDSSDEFWEYAS NNPAFTKVFNEAMACHARQAVSQILGGCREVFEGIGCLVDVG | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 11,492.075 | ||
| Theoretical pI: | 11.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 56.537 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.479 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.225 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338825.1 | 5prime_partial | 123 | 1-372(+) |
Amino Acid sequence : | |||
| APLVCVRTPSNGSRQLRDRPPNSRHPGRPRWRHVTLGALLRHRLLPFHSPPHNEILNPPGFLQAGGIHVINLLRPNSSFSSAPPTGRRKHGGVFSAAEQPGDGGSVGEAELAHPHQSESR LLR* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 11,492.075 | ||
| Theoretical pI: | 11.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 56.537 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.479 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.225 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338825.1 | 5prime_partial | 102 | 517-209(-) |
Amino Acid sequence : | |||
| SNIHQTTNPLKNLPTTTQDLRHGLPSVARHGLVEHFGERWIVRRVFPKLIGGVGTLIGEGARAQLHPPIHHHRAVLQQKIRRHAFVSLLEEQTRKRSLGVGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,492.075 | ||
| Theoretical pI: | 11.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 56.537 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.479 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.225 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338825.1 | 3prime_partial | 162 | 32-517(+) |
Amino Acid sequence : | |||
| MAAVNCAIDLQIADILEGHGGAMSLSELSSATGCSPSTLRRIMRYLIHRGFFKQEESTSSISYAQTPLSRLLLQQGDESMAAYFLLQNSPVMVDRWVKLSSRTLTNQSPDSSDEFWEYAS NNPAFTKVFNEAMACHARQAVSQILGGCREVFEGIGCLVDVG | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 11,492.075 | ||
| Theoretical pI: | 11.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 56.537 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.479 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.225 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338825.1 | 5prime_partial | 123 | 1-372(+) |
Amino Acid sequence : | |||
| APLVCVRTPSNGSRQLRDRPPNSRHPGRPRWRHVTLGALLRHRLLPFHSPPHNEILNPPGFLQAGGIHVINLLRPNSSFSSAPPTGRRKHGGVFSAAEQPGDGGSVGEAELAHPHQSESR LLR* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 11,492.075 | ||
| Theoretical pI: | 11.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 56.537 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.479 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.225 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338825.1 | 5prime_partial | 102 | 517-209(-) |
Amino Acid sequence : | |||
| SNIHQTTNPLKNLPTTTQDLRHGLPSVARHGLVEHFGERWIVRRVFPKLIGGVGTLIGEGARAQLHPPIHHHRAVLQQKIRRHAFVSLLEEQTRKRSLGVGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,492.075 | ||
| Theoretical pI: | 11.594 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 56.537 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.479 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.225 | ||
| sheet | 0.216 | ||