| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338831.1 | internal | 199 | 2-598(+) |
Amino Acid sequence : | |||
| HQLKADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIV DDGGDATLLIHEGVKAEEEYKKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPSKYRKMKERLVGVSEETTTGVKRLYQM | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 20,249.601 | ||
| Theoretical pI: | 5.246 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.989 | ||
| aromaticity | 0.015 | ||
| GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.296 | ||
| sheet | 0.342 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338831.1 | 5prime_partial | 196 | 598-8(-) |
Amino Acid sequence : | |||
| HLIQPLHTSSCFLRNTNQSLLHLPILAGIGLQPVSDQRQHYLKLRIIGRAGVRQLPRLLVLLLRLHALVDQQSSITAIVHDEVGAAARAPVEGPLRAPPVLLQGLTLPGEDGGAVASNGS GGVVLSGEDVARAPSDLSAESGKGLNEDGSLDGHVETSGDPGALEGLGGAELGPAGNEARHLHLSELDFEAAEVGL* | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 20,249.601 | ||
| Theoretical pI: | 5.246 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.989 | ||
| aromaticity | 0.015 | ||
| GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.296 | ||
| sheet | 0.342 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338831.1 | internal | 199 | 2-598(+) |
Amino Acid sequence : | |||
| HQLKADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIV DDGGDATLLIHEGVKAEEEYKKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPSKYRKMKERLVGVSEETTTGVKRLYQM | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 20,249.601 | ||
| Theoretical pI: | 5.246 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.989 | ||
| aromaticity | 0.015 | ||
| GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.296 | ||
| sheet | 0.342 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338831.1 | 5prime_partial | 196 | 598-8(-) |
Amino Acid sequence : | |||
| HLIQPLHTSSCFLRNTNQSLLHLPILAGIGLQPVSDQRQHYLKLRIIGRAGVRQLPRLLVLLLRLHALVDQQSSITAIVHDEVGAAARAPVEGPLRAPPVLLQGLTLPGEDGGAVASNGS GGVVLSGEDVARAPSDLSAESGKGLNEDGSLDGHVETSGDPGALEGLGGAELGPAGNEARHLHLSELDFEAAEVGL* | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 20,249.601 | ||
| Theoretical pI: | 5.246 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.989 | ||
| aromaticity | 0.015 | ||
| GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.296 | ||
| sheet | 0.342 | ||